PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.21372s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 195aa    MW: 21055.7 Da    PI: 9.239
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.21372s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.42.1e-301871155
               G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                          +prl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Araha.21372s0001.1.p 18 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 71
                          59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.2521374IPR017930Myb domain
SuperFamilySSF466896.45E-201575IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-301776IPR009057Homeodomain-like
TIGRFAMsTIGR015576.5E-241971IPR006447Myb domain, plants
PfamPF002492.4E-82170IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MAEGDSGTED LSGKTLKRPR LVWTPQLHKR FVDVVAHLGI KNAVPKTIMQ LMNVEGLTRE  60
NVASHLQKYR LYLKRMQGLT NEGPSASDKL FSSTPVPPQS FQDIGGGGGS SGNVGVPIQG  120
PYGAQPMMQM PVYAHHMGMQ GYHHQNHNHD PYHHHHHGAG GSGAFEANPY MMQQNKFGSM  180
ASYPSVGGGS ANEN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-221776463ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2065760.0AB206576.1 Arabidopsis thaliana PCL1 gene for PHYTOCLOCK 1, complete cds.
GenBankAK2276860.0AK227686.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-26-J19.
GenBankAL1333140.0AL133314.1 Arabidopsis thaliana DNA chromosome 3, BAC clone F12A12.
GenBankBT0064250.0BT006425.1 Arabidopsis thaliana At3g46640 gene, complete cds.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001030823.11e-123transcription factor LUX
RefseqNP_190248.11e-123transcription factor LUX
SwissprotQ9SNB41e-125PCL1_ARATH; Transcription factor LUX
TrEMBLR0HGQ91e-121R0HGQ9_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.5__1030__AT3G46640.21e-118(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40552758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.21e-110G2-like family protein